PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_6066.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 482aa    MW: 53325.7 Da    PI: 6.2678
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_6066.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1645.5e-5191361128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGf FhP+d elv +yLkkk+ g+k+e  ++i+evdiyk+ePwdLp+  +v +++++w+fF+ rd+ky++g r+nrat +gyWk+tgkd+++++ +
  MLOC_6066.1   9 LPPGFGFHPKDTELVAHYLKKKILGQKIEY-DIIPEVDIYKHEPWDLPAkcNVPTQDNKWHFFAARDRKYPNGARSNRATVAGYWKSTGKDRAIKV-D 104
                  79****************************.99***************5346667999**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++++g+kktLvf++gr p+g++t+W+mhey +
  MLOC_6066.1 105 KRTIGTKKTLVFHEGRPPTGKRTEWIMHEYYI 136
                  99****************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.68E-594158IPR003441NAC domain
PROSITE profilePS5100555.1569159IPR003441NAC domain
PfamPF023659.4E-2510135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
METLRAMALP PGFGFHPKDT ELVAHYLKKK ILGQKIEYDI IPEVDIYKHE PWDLPAKCNV  60
PTQDNKWHFF AARDRKYPNG ARSNRATVAG YWKSTGKDRA IKVDKRTIGT KKTLVFHEGR  120
PPTGKRTEWI MHEYYIDENE CQACPDMKDA FVLCKVTKRI DWTSENGNEV GNNNPQPQQP  180
NVAAILAVSV EQPDTAGSSI IGGELPSDAA TVAIPAHTTP DGDADIQQWL EELIDPSFDP  240
SANTVVDSVS AQLSPDEQNA ESSNIDAMAP KVEQDYASPN QTLADDTDFL LSDDIHSMLY  300
PGSDDFTSWQ HTYFTAADPF SLSNDFMDEF QMKELQLPLE NNGPNLSNEP AVVVRTRHGG  360
TSATSVPPYK AKARLQQRLG RMVTSSSESI NQTIKFVDNN GHLDLMTNVK HQKKHVRDIT  420
SVKQSDAGKS SGNHNNQGFF RGVQRAFRGC SATGLNILVA LCMVGVAAAI LHHGRHRSGI  480
SL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-44716213172Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU0017230.0GU001723.1 Triticum aestivum cultivar Suwon11 NAC-domain transcription factor (NAC8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566632.10.0PREDICTED: NAC domain-containing protein 74-like
SwissprotQ7GCL70.0NAC74_ORYSJ; NAC domain-containing protein 74
TrEMBLM0XJN90.0M0XJN9_HORVD; Uncharacterized protein
STRINGMLOC_6066.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75603847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17260.12e-66NAC domain containing protein 86